Structure of PDB 8cg8 Chain 5

Receptor sequence
>8cg85 (length=49) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
FSHPRRYGKGSRQCRVCSSHTGLIRKYGLNICRQCFREKANDIGFNKFR
3D structure
PDB8cg8 Cryo-EM analysis of eukaryotic ribosome translocation intermediates
Chain5
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 F8 S9 H10 R13 Y14 G15 K16 G17 R19 C24 T28 G29 L30 I31 R32 Y34 R40 Q41 C42 R44 E45 K54 F55 R56 F1 S2 H3 R6 Y7 G8 K9 G10 R12 C17 T21 G22 L23 I24 R25 Y27 R33 Q34 C35 R37 E38 K47 F48 R49
BS02 ZN 5 C21 V23 C24 C39 C42 C14 V16 C17 C32 C35
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 19:56:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8cg8', asym_id = '5', title = 'Cryo-EM analysis of eukaryotic ribosome translocation intermediates'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8cg8', asym_id='5', title='Cryo-EM analysis of eukaryotic ribosome translocation intermediates')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008270', uniprot = '', pdbid = '8cg8', asym_id = '5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008270', uniprot='', pdbid='8cg8', asym_id='5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>