Structure of PDB 8a57 Chain 5

Receptor sequence
>8a575 (length=53) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
AVPFRRTSKAKKRKRRTHVKLQLPGMNECSNCGEYRLSHHVCPECGQYDG
KDV
3D structure
PDB8a57 Structural basis for HflXr-mediated antibiotic resistance in Listeria monocytogenes.
Chain5
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 A2 V3 P4 F5 R6 R7 T8 S9 K10 A11 K13 R14 K15 R16 R17 T18 H19 N28 R37 S39 H40 Y49 D50 A1 V2 P3 F4 R5 R6 T7 S8 K9 A10 K12 R13 K14 R15 R16 T17 H18 N27 R36 S38 H39 Y48 D49
BS02 ZN 5 C30 N32 C33 C43 C46 C29 N31 C32 C42 C45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a57, PDBe:8a57, PDBj:8a57
PDBsum8a57
PubMed36300626
UniProtP66207|RL322_LISMO Large ribosomal subunit protein bL32B (Gene Name=rpmF2)

[Back to BioLiP]