Structure of PDB 7uqz Chain 5

Receptor sequence
>7uqz5 (length=73) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER
YERLAAKMHAKKVERMRRREKRN
3D structure
PDB7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chain5
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 W44 R51 K58 I76 K80 W3 R10 K17 I35 K39
BS02 rna 5 H100 K102 K103 R106 R109 R110 H59 K61 K62 R65 R68 R69
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum7uqz
PubMed36864048
UniProtP53188|CGR1_YEAST rRNA-processing protein CGR1 (Gene Name=CGR1)

[Back to BioLiP]