Structure of PDB 7rr5 Chain 5

Receptor sequence

>7rr55 (length=154) Species: 4932 (Saccharomyces cerevisiae)

EEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHG
HAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLM
NMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEA
ARTD

3D structure

• PDB: 7rr5 Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.
• Chain: 5
• Resolution: 3.23 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5	G50 X51 H52 G53 H54 K69 E71 H78	G47 X48 H49 G50 H51 K66 E68 H75
BS02	rna	5	R27 K48 X51 R87 E89 T137 A153 R155	R24 K45 X48 R84 E86 T134 A150 R152

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 12:22:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7rr5', asym_id = '5', title = 'Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7rr5', asym_id='5', title='Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003746,0043022,0045901,0045905', uniprot = '', pdbid = '7rr5', asym_id = '5'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003746,0043022,0045901,0045905', uniprot='', pdbid='7rr5', asym_id='5')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>