Structure of PDB 7pjx Chain 5

Receptor sequence
>7pjx5 (length=131) Species: 562 (Escherichia coli) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFA
KANAKFEVKAAAFEGELIPASQIDRLATLPT
3D structure
PDB7pjx Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chain5
Resolution6.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 5 N4 A28 D29 S30 G32 V33 T34 M38 L41 R42 V54 V55 R56 L59 R61 E65 G78 P79 T80 L81 N4 A28 D29 S30 G32 V33 T34 M38 L41 R42 V54 V55 R56 L59 R61 E65 G78 P79 T80 L81
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Apr 28 00:10:29 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7pjx', asym_id = '5', title = 'Structural mechanism of GTPase-powered ribosome-tRNA movement.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7pjx', asym_id='5', title='Structural mechanism of GTPase-powered ribosome-tRNA movement.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0006412,0015934', uniprot = '', pdbid = '7pjx', asym_id = '5'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0006412,0015934', uniprot='', pdbid='7pjx', asym_id='5')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>