Structure of PDB 7p7s Chain 5

Receptor sequence
>7p7s5 (length=48) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
MRVNITLECTSCKERNYLTNKNKRNNPDRLEKQKYCPRERKVTLHRET
3D structure
PDB7p7s Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chain5
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 R2 E14 R15 Y17 L18 N20 N22 N25 N26 L30 K32 Q33 K34 Y35 R38 R40 R2 E14 R15 Y17 L18 N20 N22 N25 N26 L30 K32 Q33 K34 Y35 R38 R40
BS02 ZN 5 C9 C36 E39 C9 C36 E39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7s, PDBe:7p7s, PDBj:7p7s
PDBsum7p7s
PubMed35387982
UniProtA0A1B4XR98

[Back to BioLiP]