Structure of PDB 7ohq Chain 5 |
>7ohq5 (length=51) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER Y |
|
PDB | 7ohq Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors. |
Chain | 5 |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
5 |
W44 R51 R83 |
W3 R10 R42 |
|
|
|
|