Structure of PDB 7oh3 Chain 5

Receptor sequence
>7oh35 (length=73) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER
YERLAAKMHAKKVERMRRREKRN
3D structure
PDB7oh3 Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Chain5
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 W44 K47 R51 L79 R82 R83 W3 K6 R10 L38 R41 R42
BS02 rna 5 H100 K102 R106 R109 R113 H59 K61 R65 R68 R72
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oh3, PDBe:7oh3, PDBj:7oh3
PDBsum7oh3
PubMed34813592
UniProtP53188|CGR1_YEAST rRNA-processing protein CGR1 (Gene Name=CGR1)

[Back to BioLiP]