Structure of PDB 7f0l Chain 5

Receptor sequence
>7f0l5 (length=53) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]
SKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAKY
NRV
3D structure
PDB7f0l A previously unrecognized membrane protein in the Rhodobacter sphaeroides LH1-RC photocomplex.
Chain5
Resolution2.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 SPO 5 V29 H32 V28 H31
BS02 BCL 5 F25 H32 W43 F24 H31 W42
BS03 SPO 5 F17 Q20 F16 Q19
BS04 BCL 5 L24 L27 A28 I31 H32 L23 L26 A27 I30 H31
BS05 BCL 5 F11 I31 F10 I30
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7f0l, PDBe:7f0l, PDBj:7f0l
PDBsum7f0l
PubMed34728609
UniProtQ3J1A4|LHA1_CERS4 Light-harvesting protein B-875 alpha chain (Gene Name=pufA)

[Back to BioLiP]