Structure of PDB 7ew6 Chain 5

Receptor sequence

>7ew65 (length=205) Species: 77009 (Hordeum vulgare subsp. spontaneum)

RATWLPGLDPPAYLDGTLPGDYGFDPLGLGEQPEDLKWYVQAELVHCRFA
MAGVAGILGTDLIRVSGIGNLPVWFEAGATKFDFANTTALFFVQLLLMGF
VETKRYMDFVSPGSQAKEGTFLGIEASLEGLQPGYPGGPLFNPMGLAKDI
ENANEVKLKEIKNGRLAMVAMLGFIVQASVTHAGPIDNLLTHLSDPFNKN
IIHAL

3D structure

• PDB: 7ew6 Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.
• Chain: 5
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	5	F144 T147	F100 T103
BS02	CLA	5	R92 Y179 P180 G181 V200 E204	R48 Y135 P136 G137 V156 E160
BS03	CLA	5	G217 V220 Q221 N232 H236 N244 I245	G173 V176 Q177 N188 H192 N200 I201
BS04	CLA	5	G64 D65 Y66 F68 L73 Y83 E87 R209 M212 V213	G20 D21 Y22 F24 L29 Y39 E43 R165 M168 V169
BS05	CLA	5	K203 K206 N207	K159 K162 N163
BS06	CLA	5	H236 P240 F241	H192 P196 F197
BS07	CLA	5	W48 P50 F68	W4 P6 F24
BS08	CHL	5	F119 G122 A123 F135	F75 G78 A79 F91
BS09	CHL	5	R92 F93 V145 K148 R149 D152 P180 F185	R48 F49 V101 K104 R105 D108 P136 F141
BS10	CLA	5	W82 Q85 A86 V89 H90 F93 M142 G143 E146 R149 Y150	W38 Q41 A42 V45 H46 F49 M98 G99 E102 R105 Y106

Gene Ontology

Molecular Function

• GO:0016168 chlorophyll binding

Biological Process

• GO:0009765 photosynthesis, light harvesting
• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009522 photosystem I
• GO:0009523 photosystem II
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:7ew6, PDBe:7ew6, PDBj:7ew6
• PDBsum: 7ew6
• PubMed: 34879391
• UniProt: F2CW18