Structure of PDB 7acj Chain 5

Receptor sequence

>7acj5 (length=150) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

SATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRD
GEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYT
VVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR

3D structure

PDB

7acj Structures of tmRNA and SmpB as they transit through the ribosome.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	5	A15 L16 K48 N69 T71	A5 L6 K38 N59 T61
BS02	rna	5	K18 H22 D98 Y101 N105 R106 K143 R145 V149 R153 K156	K8 H12 D88 Y91 N95 R96 K133 R135 V139 R143 K146
BS03	rna	5	Y24 L34 L36 G38 V41 K42 R45 Y55 L91 L92 N93 Q94 G108 Y109 T110 A121 W122 C123 K124 K134	Y14 L24 L26 G28 V31 K32 R35 Y45 L81 L82 N83 Q84 G98 Y99 T100 A111 W112 C113 K114 K124
BS04	MG	5	K143 W147	K133 W137

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0070929	trans-translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7acj, PDBe:7acj, PDBj:7acj
PDBsum	7acj
PubMed	34389707
UniProt	P0A832\|SSRP_ECOLI SsrA-binding protein (Gene Name=smpB)

[Back to BioLiP]