Structure of PDB 7abz Chain 5

Receptor sequence
>7abz5 (length=146) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
IALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEA
FLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVA
LSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAH
3D structure
PDB7abz Structures of tmRNA and SmpB as they transit through the ribosome.
Chain5
Resolution3.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 I14 L16 I1 L3
BS02 rna 5 R19 H22 Y55 Y101 N105 R106 K134 Q135 H136 R139 R145 R6 H9 Y42 Y88 N92 R93 K121 Q122 H123 R126 R132
BS03 rna 5 L36 G38 V41 K42 R45 L91 L92 N93 N120 A121 W122 K156 N157 L23 G25 V28 K29 R32 L78 L79 N80 N107 A108 W109 K143 N144
Gene Ontology
Biological Process
GO:0070929 trans-translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7abz, PDBe:7abz, PDBj:7abz
PDBsum7abz
PubMed34389707
UniProtP0A832|SSRP_ECOLI SsrA-binding protein (Gene Name=smpB)

[Back to BioLiP]