Structure of PDB 6w6p Chain 5

Receptor sequence

>6w6p5 (length=64) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]

PKQKTHRGLAKRVKRTGGGGLKRGRAFTSHRFHGKTKKQRRQLRKASMVA
KGDYKRIRQQLARM

3D structure

PDB

6w6p Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5	P2 K3 Q4 K5 T6 R8 K12 R13 K15 T17 G18 G19 K23 R24 R26 A27 F28 S30 H31 R32 F33 H34 K38 K39 Q40 R42 R45 K46 D54 K56 R57 Q60 R64	P1 K2 Q3 K4 T5 R7 K11 R12 K14 T16 G17 G18 K22 R23 R25 A26 F27 S29 H30 R31 F32 H33 K37 K38 Q39 R41 R44 K45 D53 K55 R56 Q59 R63

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links