Structure of PDB 6szs Chain 5

Receptor sequence
>6szs5 (length=65) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFN
3D structure
PDB6szs Release factor-dependent ribosome rescue by BrfA in the Gram-positive bacterium Bacillus subtilis.
Chain5
Resolution3.06 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 M1 K2 H6 M1 K2 H6
BS02 rna 5 R59 R63 R59 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006413 translational initiation
GO:1904689 negative regulation of cytoplasmic translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6szs, PDBe:6szs, PDBj:6szs
PDBsum6szs
PubMed31776341
UniProtP0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]