Structure of PDB 6o90 Chain 5

Receptor sequence
>6o905 (length=64) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
PKQKTHRGLAKRVKRTGGGGLKRGRAFTSHRFHGKTKKQRRQLRKASMVA
KGDYKRIRQQLARM
3D structure
PDB6o90 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
Chain5
Resolution3.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 P2 Q4 K5 H7 R8 K12 R13 G19 K23 R26 A27 F28 H31 R32 F33 K38 K39 Q40 R42 R45 K46 K52 R57 R59 Q60 R64 P1 Q3 K4 H6 R7 K11 R12 G18 K22 R25 A26 F27 H30 R31 F32 K37 K38 Q39 R41 R44 K45 K51 R56 R58 Q59 R63
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o90, PDBe:6o90, PDBj:6o90
PDBsum6o90
PubMed33004869
UniProtA0A1B4XM73

[Back to BioLiP]