Structure of PDB 6o7k Chain 5

Receptor sequence
>6o7k5 (length=71) Species: 562 (Escherichia coli) [Search protein sequence]
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPG
DRVVVEITPYDPTRGRIVYRK
3D structure
PDB6o7k Late steps in bacterial translation initiation visualized using time-resolved cryo-EM.
Chain5
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 A1 K2 L17 P18 N19 Y35 G38 K39 R41 M42 R46 R66 A1 K2 L17 P18 N19 Y35 G38 K39 R41 M42 R46 R66
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0019843 rRNA binding
GO:0043022 ribosome binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6o7k, PDBe:6o7k, PDBj:6o7k
PDBsum6o7k
PubMed31108498
UniProtQ5SHR1|IF1_THET8 Translation initiation factor IF-1 (Gene Name=infA)

[Back to BioLiP]