Structure of PDB 6ft6 Chain 5

Receptor sequence
>6ft65 (length=73) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENER
YERLAAKMHAKKVERMRRREKRN
3D structure
PDB6ft6 Structure of the nuclear exosome captured on a maturing preribosome.
Chain5
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 W44 R51 R82 R83 W3 R10 R41 R42
BS02 rna 5 H100 K102 K103 R106 R109 R110 H59 K61 K62 R65 R68 R69
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ft6, PDBe:6ft6, PDBj:6ft6
PDBsum6ft6
PubMed29519915
UniProtP53188|CGR1_YEAST rRNA-processing protein CGR1 (Gene Name=CGR1)

[Back to BioLiP]