Structure of PDB 5zeb Chain 5

Receptor sequence
>5zeb5 (length=45) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
KGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVANRRSKGRRALTA
3D structure
PDB5zeb Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
Chain5
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 5 K3 K5 R6 T7 F8 Q9 P10 N11 N12 R13 R14 R15 A16 R17 H19 G20 F21 R22 R24 R26 R28 A29 I33 R37 R38 K40 G41 R42 R43 K1 K3 R4 T5 F6 Q7 P8 N9 N10 R11 R12 R13 A14 R15 H17 G18 F19 R20 R22 R24 R26 A27 I31 R35 R36 K38 G39 R40 R41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5zeb, PDBe:5zeb, PDBj:5zeb
PDBsum5zeb
PubMed30206241
UniProtA0R7K0|RL34_MYCS2 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]