Structure of PDB 5yq7 Chain 5

Receptor sequence
>5yq75 (length=36) Species: 120962 (Roseiflexus castenholzii) [Search protein sequence]
PFEFRTSVVVSTLLGLVMALLIHFVVLSSGAFNWLR
3D structure
PDB5yq7 Cryo-EM structure of the RC-LH core complex from an early branching photosynthetic prokaryote.
Chain5
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 KGD 5 H27 F28 H23 F24
BS02 BCL 5 V13 T16 L20 H27 W38 V9 T12 L16 H23 W34
BS03 KGD 5 T16 M22 T12 M18
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5yq7, PDBe:5yq7, PDBj:5yq7
PDBsum5yq7
PubMed29674684
UniProtQ83XD1

[Back to BioLiP]