Structure of PDB 5wf0 Chain 5

Receptor sequence
>5wf05 (length=131) Species: 562 (Escherichia coli) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFA
KANAKFEVKAAAFEGELIPASQIDRLATLPT
3D structure
PDB5wf0 Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
Chain5
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 5 D29 S30 R31 G32 T34 K37 M38 L41 R53 V54 V55 R56 N57 T58 L59 L60 R61 R62 E65 G78 P79 T80 L81 D29 S30 R31 G32 T34 K37 M38 L41 R53 V54 V55 R56 N57 T58 L59 L60 R61 R62 E65 G78 P79 T80 L81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wf0, PDBe:5wf0, PDBj:5wf0
PDBsum5wf0
PubMed29733411
UniProtP0A7J3|RL10_ECOLI Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]