Structure of PDB 3j46 Chain 5

Receptor sequence

>3j465 (length=234) Species: 562 (Escherichia coli)

MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN

3D structure

• PDB: 3j46 Structure of the SecY channel during initiation of protein translocation.
• Chain: 5
• Resolution: 10.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	5	M1 A2 K3 L4 T5 K6 R7 M8 R12 V15 D16 F38 D43 D51 R53 R71 K105 K106 G107 E108 N110 F111 D112 V130 L131 G132 P133 R134 R164 N165 D166 K167 N168 H172 T174 S215 M218 G219 A220	M1 A2 K3 L4 T5 K6 R7 M8 R12 V15 D16 F38 D43 D51 R53 R71 K105 K106 G107 E108 N110 F111 D112 V130 L131 G132 P133 R134 R164 N165 D166 K167 N168 H172 T174 S215 M218 G219 A220

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006417 regulation of translation
• GO:0045947 negative regulation of translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j46, PDBe:3j46, PDBj:3j46
• PDBsum: 3j46
• PubMed: 24153188
• UniProt: P0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)