Structure of PDB 8h6k Chain 4c

Receptor sequence

>8h6k4c (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]

TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWT
NKDRYISKMFLRGDSVIVVLRNPL

3D structure

PDB

8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4c	R47 N48 N49 G103 D104	R22 N23 N24 G63 D64

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034715	pICln-Sm protein complex
GO:0034719	SMN-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0070062	extracellular exosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum	8h6k
PubMed	38658629
UniProt	P62316\|SMD2_HUMAN Small nuclear ribonucleoprotein Sm D2 (Gene Name=SNRPD2)