Structure of PDB 8h6j Chain 4R

Receptor sequence

>8h6j4R (length=106) Species: 9606 (Homo sapiens)

EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK

3D structure

• PDB: 8h6j Atomic structures of human exon-defined spliceosome prior to activation.
• Chain: 4R
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4R	D387 S449 R450	D19 S81 R82
BS02	rna	4R	W376 F384 C385 G386 D387 K411 V412 I413 Y424 G425 F426 R455 K456	W8 F16 C17 G18 D19 K43 V44 I45 Y56 G57 F58 R87 K88

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:8h6j, PDBe:8h6j, PDBj:8h6j
• PDBsum: 8h6j
• PubMed: 38658629
• UniProt: Q9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)