Structure of PDB 8h6k Chain 4I

Receptor sequence
>8h6k4I (length=75) Species: 9606 (Homo sapiens) [Search protein sequence]
QPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKE
EEKASKEFAAMEAAALKAYQEDLKR
3D structure
PDB8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
Chain4I
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4I I20 H30 G33 K34 I13 H23 G26 K27
BS02 ZN 4I C13 C16 H30 H36 C6 C9 H23 H29
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0070064 proline-rich region binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum8h6k
PubMed38658629
UniProtO75554|WBP4_HUMAN WW domain-binding protein 4 (Gene Name=WBP4)

[Back to BioLiP]