Structure of PDB 8ugl Chain 4F |
>8ugl4F (length=97) Species: 9823 (Sus scrofa) [Search protein sequence] |
ASGGGVPTDEEQATGLEREVMMAARKGLDPYNILAPKAASGTKEDPNLVP SITNKRIVGCICEEDNSTVIWFWVHKGETQRCPSCGTHYKLVSHQLA |
|
PDB | 8ugl High-resolution in situ structures of mammalian respiratory supercomplexes. |
Chain | 4F |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
4F |
C60 C62 C82 C85 |
C60 C62 C82 C85 |
|
|
|
|