Structure of PDB 8h6k Chain 4F

Receptor sequence
>8h6k4F (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
3D structure
PDB8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
Chain4F
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4F G95 T96 G97 N98 S137 G94 T95 G96 N97 S136
BS02 rna 4F T138 K139 Y140 Y142 T137 K138 Y139 Y141
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum8h6k
PubMed38658629
UniProtP83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)

[Back to BioLiP]