Structure of PDB 8h6k Chain 4D

Receptor sequence

>8h6k4D (length=376) Species: 9606 (Homo sapiens) [Search protein sequence]

AKLWDSKMFAEIMMKIEEYISKQAKASEVAAPEYRVIVDANNLTVEIENE
LNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQ
QILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYE
YVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQR
KTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVD
SFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGG
RRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGR
VRQTQVNEATKARISKTLQRTLQKQS

3D structure

PDB

8h6k Structural Insights into Human Exon-defined Spliceosome Prior to Activation.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4D	L347 Q350 R351 K352 K353 R354 G355 G356 Y359 R360 K363	L291 Q294 R295 K296 K297 R298 G299 G300 Y303 R304 K307
BS02	rna	4D	C247 N248 L251 L252 T265 H270 K298 K327 K338 Q350 R351 R354 R357 R358 R365 R419 S421 K422 T423	C191 N192 L195 L196 T209 H214 K242 K271 K282 Q294 R295 R298 R301 R302 R309 R363 S365 K366 T367

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0030621	U4 snRNA binding
GO:0030622	U4atac snRNA binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0043021	ribonucleoprotein complex binding
GO:0070990	snRNP binding

	Biological Process
GO:0000244	spliceosomal tri-snRNP complex assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0048254	snoRNA localization
GO:0071166	ribonucleoprotein complex localization

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005687	U4 snRNP
GO:0005690	U4atac snRNP
GO:0015030	Cajal body
GO:0016607	nuclear speck
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071005	U2-type precatalytic spliceosome
GO:0071011	precatalytic spliceosome
GO:0071339	MLL1 complex
GO:0097526	spliceosomal tri-snRNP complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8h6k, PDBe:8h6k, PDBj:8h6k
PDBsum	8h6k
PubMed	38658629
UniProt	Q8WWY3\|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]