Structure of PDB 8ugl Chain 4A

Receptor sequence

>8ugl4A (length=513) Species: 9823 (Sus scrofa)

FVNRWLYSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDD
QIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMS
FWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLH
LAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPV
LAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGF
GMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDT
RAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVG
GLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFS
GYTLNQAWAKIHFVIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTAWN
TISSMGSFISLTAVMLMIFIIWEAFASKREVSAVELTSTNLEWLHGCPPP
YHTFEEPTYINLK

3D structure

• PDB: 8ugl High-resolution in situ structures of mammalian respiratory supercomplexes.
• Chain: 4A
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEA	4A	S34 R38 V58 H61 A62 M65 M69 G125 W126 Y371 F377 H378 L381 V386 M390 F425 Q428 R439 M468	S33 R37 V57 H60 A61 M64 M68 G124 W125 Y370 F376 H377 L380 V385 M389 F424 Q427 R438 M467
BS02	HEA	4A	W126 W236 V243 Y244 H290 H291 T316 G317 G352 G355 I356 L358 A359 D364 H368 H376 F377 V380 L381 R438	W125 W235 V242 Y243 H289 H290 T315 G316 G351 G354 I355 L357 A358 D363 H367 H375 F376 V379 L380 R437
BS03	CU	4A	H240 H290 H291	H239 H289 H290
BS04	MG	4A	H368 D369	H367 D368

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
• GO:0015990 electron transport coupled proton transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:8ugl, PDBe:8ugl, PDBj:8ugl
• PDBsum: 8ugl
• PubMed: 38811722
• UniProt: O79876|COX1_PIG Cytochrome c oxidase subunit 1 (Gene Name=MT-CO1)