Structure of PDB 6qx9 Chain 4A

Receptor sequence

>6qx94A (length=239) Species: 9606 (Homo sapiens)

PEIEWWDSYIIFGITNLVEHPAQLNPPVTLGVYLTKKEQKKLRRQTRREA
QKELQEKVRLGLMPPPEPKPTKVEAHVRAQMAKRQKAHEEANAARKLTAE
QRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKIEANAGQLYLTGVV
VLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDTNKCVLVWEGTAKDRSFG
EMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD

3D structure

• PDB: 6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
• Chain: 4A
• Resolution: 3.28 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4A	K446 R449 R453 Q457 P474 K475 N515 R518 K519 L520 K528 P554 A555 F558 K559 N563 Q566 R596 R601	K40 R43 R47 Q51 P68 K69 N92 R95 K96 L97 K105 P131 A132 F135 K136 N140 Q143 R173 R178
BS02	rna	4A	R449 R453 Q461 R465 R507 H511 K526 L533 Q566 Y568	R43 R47 Q55 R59 R84 H88 K103 L110 Q143 Y145

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0042802 identical protein binding

Biological Process

• GO:0000244 spliceosomal tri-snRNP complex assembly
• GO:0000375 RNA splicing, via transesterification reactions
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0015030 Cajal body
• GO:0016607 nuclear speck
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
• PDBsum: 6qx9
• PubMed: 30975767
• UniProt: O43395|PRPF3_HUMAN U4/U6 small nuclear ribonucleoprotein Prp3 (Gene Name=PRPF3)