Structure of PDB 5el5 Chain 4A

Receptor sequence

>5el54A (length=111) Species: 300852 (Thermus thermophilus HB8)

EIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLR
EYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNA
RTRKGPRKTVA

3D structure

• PDB: 5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 4A
• Resolution: 3.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4A	K13 R14 Y21 Y23 G24 I25 G26 K27 A28 R29 R44 V74 N77 Y87 R88 L96 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K115 T116	K6 R7 Y14 Y16 G17 I18 G19 K20 A21 R22 R37 V67 N70 Y80 R81 L89 V91 R92 Q94 R95 T96 R97 T98 N99 A100 R101 T102 K104 R107 K108 T109

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el5, PDBe:5el5, PDBj:5el5
• PDBsum: 5el5
• PubMed: 26791911
• UniProt: P80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)