Structure of PDB 5e7k Chain 4A

Receptor sequence
>5e7k4A (length=111) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
EIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLR
EYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNA
RTRKGPRKTVA
3D structure
PDB5e7k Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Chain4A
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4A K13 R14 V17 Y21 Y23 G24 I25 G26 A28 R29 R44 V74 N77 Y87 P97 V98 R99 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K115 T116 K6 R7 V10 Y14 Y16 G17 I18 G19 A21 R22 R37 V67 N70 Y80 P90 V91 R92 R95 T96 R97 T98 N99 A100 R101 T102 K104 R107 K108 T109
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5e7k, PDBe:5e7k, PDBj:5e7k
PDBsum5e7k
PubMed26791911
UniProtP80377|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]