Structure of PDB 5el6 Chain 49

Receptor sequence

>5el649 (length=179) Species: 300852 (Thermus thermophilus HB8)

DVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARIL
EKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFL
EKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALR
GMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 5el6 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
• Chain: 49
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	49	S76 S78	S73 S75
BS02	rna	49	K36 N40 G42 L43 G44 E45 K47 T71 K74 F80 I88 R91 S124 D126 R128 N132 L135 G154 M155 D156 A158	K33 N37 G39 L40 G41 E42 K44 T68 K71 F77 I85 R88 S121 D123 R125 N129 L132 G151 M152 D153 A155
BS03	rna	49	N27 W29 Q66 K67 P68 A69 V70 R91 V92 T93 R95 R96	N24 W26 Q63 K64 P65 A66 V67 R88 V89 T90 R92 R93

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5el6, PDBe:5el6, PDBj:5el6
• PDBsum: 5el6
• PubMed: 26791911
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)