Structure of PDB 4wzo Chain 49

Receptor sequence

>4wzo49 (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4wzo Structural insights into the translational infidelity mechanism.
• Chain: 49
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	49	S76 I77 S78	S75 I76 S77
BS02	rna	49	N40 G42 L43 G44 E45 T71 R72 K74 N79 F80 I88 D126 R128 N132 L133 G134 L135 R136 G154 M155 D156 A158	N39 G41 L42 G43 E44 T70 R71 K73 N78 F79 I87 D125 R127 N131 L132 G133 L134 R135 G153 M154 D155 A157
BS03	rna	49	N27 V28 W29 Q66 K67 V70 R91 V92 T93 R95 R98	N26 V27 W28 Q65 K66 V69 R90 V91 T92 R94 R97

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wzo, PDBe:4wzo, PDBj:4wzo
• PDBsum: 4wzo
• PubMed: 26037619
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)