Structure of PDB 5ib7 Chain 45

Receptor sequence

>5ib745 (length=138) Species: 300852 (Thermus thermophilus HB8)

LMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAAR
VAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGR
VMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDE

3D structure

• PDB: 5ib7 The ribosome prohibits the GU wobble geometry at the first position of the codon-anticodon helix.
• Chain: 45
• Resolution: 2.99 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	45	R51 R56 R60	R50 R55 R59
BS02	rna	45	P4 R5 R6 K8 Y9 K11 Q12 Q13 R14 G15 R16 K22 G23 Y26 F29 Q46 A49 R56 K63 R67 F69 D71 Y74 K76 K77 E80 V81 R82 M83 G84 K85 G86 K87 G88 R101 R119 H123 K124 P126 K128	P3 R4 R5 K7 Y8 K10 Q11 Q12 R13 G14 R15 K21 G22 Y25 F28 Q45 A48 R55 K62 R66 F68 D70 Y73 K75 K76 E79 V80 R81 M82 G83 K84 G85 K86 G87 R100 R118 H122 K123 P125 K127
BS03	rna	45	R16 L17	R15 L16
BS04	MG	45	G122 L125 I127	G121 L124 I126

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ib7, PDBe:5ib7, PDBj:5ib7
• PDBsum: 5ib7
• PubMed: 27174928
• UniProt: P60489|RL16_THET8 Large ribosomal subunit protein uL16 (Gene Name=rplP)