Structure of PDB 7qb5 Chain 444 |
>7qb5444 (length=57) Species: 12089 (Coxsackievirus A24) [Search protein sequence] |
GAQVSSQKVGAHVNYTTINYYKDSASNAASKLDFSQDPSKFTEPVKDIMI KTAPALN |
|
PDB | 7qb5 Exploring divalent conjugates of 5- N -acetyl-neuraminic acid as inhibitors of coxsackievirus A24 variant (CVA24v) transduction. |
Chain | 444 |
Resolution | 1.728 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
444 |
K63 A65 |
K51 A53 |
|
|
|
|