Structure of PDB 7a5i Chain 43

Receptor sequence

>7a5i43 (length=36) Species: 9606 (Homo sapiens)

KNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQ

3D structure

• PDB: 7a5i Elongational stalling activates mitoribosome-associated quality control.
• Chain: 43
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	43	K67 N68 K69 T70 V71 K74 R75 K83 R84 R85 G86 W88 Y89 Y91 P96 R97 K99 R101	K1 N2 K3 T4 V5 K8 R9 K17 R18 R19 G20 W22 Y23 Y25 P30 R31 K33 R35
BS02	ZN	43	C92 H98	C26 H32

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:0016604 nuclear body
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a5i, PDBe:7a5i, PDBj:7a5i
• PDBsum: 7a5i
• PubMed: 33243891
• UniProt: Q9P0J6|RM36_HUMAN Large ribosomal subunit protein bL36m (Gene Name=MRPL36)