Structure of PDB 6gsj Chain 42

Receptor sequence

>6gsj42 (length=150) Species: 300852 (Thermus thermophilus HB8)

TDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPL
AVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAG
AVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRK

3D structure

• PDB: 6gsj Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
• Chain: 42
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	42	R14 T16 A17 R18 M19 Q20 A21 G22 R24 R25 R27 F45 K47 K57 G85 A86 A95 A102 L119 T120 K121 E122 S125 R126 N127 N130	R11 T13 A14 R15 M16 Q17 A18 G19 R21 R22 R24 F42 K44 K54 G82 A83 A92 A99 L116 T117 K118 E119 S122 R123 N124 N127
BS02	rna	42	R15 F26 F28	R12 F23 F25
BS03	MG	42	E68 D147	E65 D144

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gsj, PDBe:6gsj, PDBj:6gsj
• PDBsum: 6gsj
• PubMed: 29931292
• UniProt: Q5SHQ5|RS5_THET8 Small ribosomal subunit protein uS5 (Gene Name=rpsE)