Structure of PDB 7vd5 Chain 41

Receptor sequence

>7vd541 (length=162)

FENELGAQPPLGFFDPLGLVEDGNQAKFDRLRYVELKHGRISMLAVVGYL
IEKAGIRLPGNISYDGTSFADIPDGFAALSKIPDAGLFQLFAFIGFLEVF
VMKDITGGEFVGDFRNGFIDFGWDSFDEETKLKKRAIELNQGRAAMMGIL
ALMVHEKLGVSL

3D structure

• PDB: 7vd5 Structural basis for different types of hetero-tetrameric light-harvesting complexes in a diatom PSII-FCPII supercomplex
• Chain: 41
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	41	G40 F47 D49 L53 F62 L65 R66 E69 H72 R177 M180	G6 F13 D15 L19 F28 L31 R32 E35 H38 R143 M146
BS02	CLA	41	L78 A79 G82 E86 R91 L92 F103 I106 I116	L44 A45 G48 E52 R57 L58 F69 I72 I82
BS03	CLA	41	I96 S97 Y98 P117 A119 G120 Q123 F127	I62 S63 Y64 P83 A85 G86 Q89 F93
BS04	CLA	41	Y67 V68 K71 H72 I75 F125 I128 G129 E132	Y33 V34 K37 H38 I41 F91 I94 G95 E98
BS05	KC1	41	R74 M77 L78 F144 D147 F148 R149 F155 W157 K168 R169 E172 Q175	R40 M43 L44 F110 D113 F114 R115 F121 W123 K134 R135 E138 Q141
BS06	CLA	41	P43 P44 N174	P9 P10 N140
BS07	CLA	41	I171 Q175	I137 Q141
BS08	CLA	41	L184 V188 H189 L192 V194	L150 V154 H155 L158 V160
BS09	A86	41	M77 V80 F155 Q175 A179 G182 L186	M43 V46 F121 Q141 A145 G148 L152
BS10	DD6	41	F48 P50 H72 A79 G109 M180 M187	F14 P16 H38 A45 G75 M146 M153
BS11	A86	41	N174 R177 A178 M181	N140 R143 A144 M147
BS12	A86	41	K71 I75 N95 I96 S97 Y98 L124 I128 E132 M136	K37 I41 N61 I62 S63 Y64 L90 I94 E98 M102
BS13	DD6	41	F148 N150 F152 I153 F155 K168	F114 N116 F118 I119 F121 K134

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 04:16:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7vd5', asym_id = '41', title = 'Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7vd5', asym_id='41', title='Structural basis for different types of hetero-t...ing complexes in a diatom PSII-FCPII supercomplex')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009765,0016020', uniprot = '', pdbid = '7vd5', asym_id = '41'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009765,0016020', uniprot='', pdbid='7vd5', asym_id='41')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>