Structure of PDB 6gsj Chain 41

Receptor sequence

>6gsj41 (length=179) Species: 300852 (Thermus thermophilus HB8)

LDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARI
LEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIF
LEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDAL
RGMDIAVVTTAETDEEARALLELLGFPFR

3D structure

• PDB: 6gsj Tautomeric G•U pairs within the molecular ribosomal grip and fidelity of decoding in bacteria.
• Chain: 41
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	41	K36 V38 N40 G42 G44 E45 T71 A73 K74 I77 N79 F80 L82 I88 R91 S124 D126 R128 N132 L133 G134 L135 R136 G154 M155 D156 A158	K34 V36 N38 G40 G42 E43 T69 A71 K72 I75 N77 F78 L80 I86 R89 S122 D124 R126 N130 L131 G132 L133 R134 G152 M153 D154 A156
BS02	rna	41	N27 V28 W29 E30 Q66 K67 A69 V70 R72 V92 T93 R95 R96	N25 V26 W27 E28 Q64 K65 A67 V68 R70 V90 T91 R93 R94
BS03	MG	41	G129 N130 T161	G127 N128 T159

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gsj, PDBe:6gsj, PDBj:6gsj
• PDBsum: 6gsj
• PubMed: 29931292
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)