Structure of PDB 4wro Chain 41

Receptor sequence

>4wro41 (length=181) Species: 300852 (Thermus thermophilus HB8)

PLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 4wro Structural insights into the translational infidelity mechanism.
• Chain: 41
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	41	K36 V38 N40 G42 G44 E45 T71 A73 K74 I77 N79 I88 R91 S124 D126 R128 N132 L133 G134 L135 G154 D156	K35 V37 N39 G41 G43 E44 T70 A72 K73 I76 N78 I87 R90 S123 D125 R127 N131 L132 G133 L134 G153 D155
BS02	rna	41	N27 W29 E30 Q66 K67 A69 V70 R72 V92 T93 R95 R96	N26 W28 E29 Q65 K66 A68 V69 R71 V91 T92 R94 R95
BS03	MG	41	G129 N130 T161	G128 N129 T160
BS04	MG	41	N123 F125	N122 F124

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wro, PDBe:4wro, PDBj:4wro
• PDBsum: 4wro
• PubMed: 26037619
• UniProt: Q5SHQ0|RL5_THET8 Large ribosomal subunit protein uL5 (Gene Name=rplE)