Structure of PDB 8wkq Chain 4 |
>8wkq4 (length=164) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
DLNDAQLKFANDVESRIQRRIEAILSPIVGNGNVHAQVTAQLDFANKEQT EEHYSPNGDASKATLRSRQLNISEQVGAGPRSTQRNETSNYEVDRTIRHT KMNVGDIERLSVAVVVNYKTLADGKPLPLTADQMKQIEDLTREAMGFSDK RGDTLNVVNSPFSA |
|
PDB | 8wkq Cryo-EM structure of the MS ring (C1) with export apparatus and proximal rod within the flagellar motor-hook complex in the CW state. |
Chain | 4 |
Resolution | 3.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
4 |
P355 S357 |
P80 S82 |
|
|
|