Structure of PDB 8wib Chain 4

Receptor sequence

>8wib4 (length=59) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

MKTGIHPEYVDTTVQCGCGHSFTTRSTKQSGTIVVEVCSQCHPFYTGKGR
VARFEKRYG

3D structure

• PDB: 8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: 4
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4	R60 R64	R53 R57

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wib, PDBe:8wib, PDBj:8wib
• PDBsum: 8wib
• PubMed: 38245551
• UniProt: A0R215|RL31_MYCS2 Large ribosomal subunit protein bL31 (Gene Name=rpmE)