Structure of PDB 8wck Chain 4

Receptor sequence

>8wck4 (length=170) Species: 240364 (Chaetoceros neogracilis) [Search protein sequence]

SEIELGVTEPLGVYDPLGWLESEPEAFERRRAVERKHGRVAMAAVVGTIV
HNNHIVFDGYLSPSNNLKFSDIPTGVDGIRAIPTAGLAQILAFFALVELA
WMPASKYDGDYGVGYFGTDIKDPEEKARKLNVELNNGRAAMMGIMGNMVA
EVLTGQTMYEQYASGHISPF

3D structure

PDB

8wck Structural and spectroscopic insights into fucoxanthin chlorophyll a/c-binding proteins of diatoms in diverse oligomeric states.

Chain

Resolution

2.71 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	4	P40 N161 V162 N165	P10 N131 V132 N135
BS02	CLA	4	A130 W131	A100 W101
BS03	A86	4	N165 M172	N135 M142
BS04	A86	4	Y90 L91 P93 I120 F124 E128	Y60 L61 P63 I90 F94 E98
BS05	A86	4	Y44 P46 V70 A74 G105 V106 G108 M171 I174	Y14 P16 V40 A44 G75 V76 G78 M141 I144
BS06	A86	4	M72 G144 Y145 F146 N166 G173 M188 Y192	M42 G114 Y115 F116 N136 G143 M158 Y162
BS07	A86	4	N82 N83 Y189 Y192	N52 N53 Y159 Y162
BS08	CLA	4	Y44 W49 F57 R60 R61 E64 R168 M171	Y14 W19 F27 R30 R31 E34 R138 M141
BS09	KC2	4	R59 V63 H67	R29 V33 H37
BS10	CLA	4	A73 A74 V76 G77 V80 H81 V86 F87 F99 I102 G108 I112	A43 A44 V46 G47 V50 H51 V56 F57 F69 I72 G78 I82
BS11	KC2	4	L91 S92 P93 S94 P113 G116 Q119 I120	L61 S62 P63 S64 P83 G86 Q89 I90
BS12	KC1	4	R59 K66 H67 L121 A125 E128 L129 A134 Y137	R29 K36 H37 L91 A95 E98 L99 A104 Y107
BS13	CLA	4	R69 M72 G139 D140 Y141 V143 G144 Y145 D149 I150 K159 L160 E163 N166	R39 M42 G109 D110 Y111 V113 G114 Y115 D119 I120 K129 L130 E133 N136
BS14	KC1	4	Y145 R158 K159 V162 N166	Y115 R128 K129 V132 N136
BS15	CLA	4	M172 G173 G176 Q191 I197 P199	M142 G143 G146 Q161 I167 P169
BS16	CLA	4	V106 I109 R110 M178	V76 I79 R80 M148

External links

PDB	RCSB:8wck, PDBe:8wck, PDBj:8wck
PDBsum	8wck
PubMed	39030906
UniProt	A0A679BXP6

[Back to BioLiP]