Structure of PDB 8v9l Chain 4

Receptor sequence
>8v9l4 (length=54) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
AVPKRRMSRANTRSRRAQWKAEAPGLVTVSVAGQQRKVPRRLLKAARLGL
VDLD
3D structure
PDB8v9l A new family of bacterial ribosome hibernation factors
Chain4
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 4 A2 V3 P4 K5 R6 R7 M8 S9 R10 A11 N12 R14 S15 R16 R17 A18 W20 V28 R41 K45 R48 A1 V2 P3 K4 R5 R6 M7 S8 R9 A10 N11 R13 S14 R15 R16 A17 W19 V27 R40 K44 R47
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum8v9l
PubMed38355796
UniProtA0R3I9|RL32_MYCS2 Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]