Structure of PDB 8s1p Chain 4

Receptor sequence
>8s1p4 (length=37) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKVRPSVKPICEKCKVIRRKGKVMVICENPKHKQKQG
3D structure
PDB8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
Chain4
Resolution1.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna 4 M1 K2 R4 P5 S6 V7 K8 R19 K20 P30 K31 K33 K35 Q36 G37 M1 K2 R4 P5 S6 V7 K8 R19 K20 P30 K31 K33 K35 Q36 G37
BS02 ZN 4 C11 C14 C27 H32 C11 C14 C27 H32
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
PDBsum8s1p
PubMed38811035
UniProtP20278|RL36_BACSU Large ribosomal subunit protein bL36 (Gene Name=rpmJ)

[Back to BioLiP]