Structure of PDB 8rjd Chain 4

Receptor sequence

>8rjd4 (length=31) Species: 9615 (Canis lupus familiaris) [Search protein sequence]

VAKQRIRMANEKHSKNITQRGNVAKTSRNAP

3D structure

PDB

8rjd UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.78574 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	4	Q5 N11 N17 I18 R21 V24 K26	Q4 N10 N16 I17 R20 V23 K25

Gene Ontology

	Biological Process
GO:0001501	skeletal system development
GO:0006006	glucose metabolic process
GO:0006986	response to unfolded protein
GO:0009791	post-embryonic development
GO:0030073	insulin secretion
GO:0030968	endoplasmic reticulum unfolded protein response
GO:0032024	positive regulation of insulin secretion
GO:0045727	positive regulation of translation
GO:0046622	positive regulation of organ growth
GO:0048644	muscle organ morphogenesis
GO:0060124	positive regulation of growth hormone secretion

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005881	cytoplasmic microtubule
GO:0016020	membrane

External links