Structure of PDB 8q4f Chain 4 |
>8q4f4 (length=60) Species: 562 (Escherichia coli) [Search protein sequence] |
MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQGR VDRFNKRFNI |
|
PDB | 8q4f Structure of arbekacin bound Escherichia coli 70S ribosome |
Chain | 4 |
Resolution | 3.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
4 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|