Structure of PDB 8p2h Chain 4 |
>8p2h4 (length=77) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] |
MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDI SSDSHPFYTGRQKFAAADGRVERFNKK |
|
PDB | 8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state |
Chain | 4 |
Resolution | 2.49 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
4 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|