Structure of PDB 8khf Chain 4 |
>8khf4 (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYA ILGFALSEAMGLFCLMVAFLILFAM |
|
PDB | 8khf Structure of Mycobacterium tuberculosis ATP synthase |
Chain | 4 |
Resolution | 3.13 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
BQ1 |
4 |
E58 L62 L65 |
E58 L62 L65 |
|
|
|
|