Structure of PDB 8j7b Chain 4

Receptor sequence

>8j7b4 (length=196) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]

KGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWA
MLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYV
EIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKE
KELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQT

3D structure

PDB

8j7b Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)

Chain

Resolution

3.22 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CHL	4	H151 Y152	H98 Y99
BS02	CHL	4	Y128 G131	Y75 G78
BS03	CLA	4	G73 N75 F77 L82 F92 V93 E96 N99 R210 M213	G20 N22 F24 L29 F39 V40 E43 N46 R157 M160
BS04	CLA	4	W57 L58 P59 F77	W4 L5 P6 F24
BS05	CHL	4	Y152 R156 N168 Q169 D170 P171 F173 Y176	Y99 R103 N115 Q116 D117 P118 F120 Y123
BS06	CLA	4	W91 A95 V98 W102 F147 F150 H151 E154 R157 W158	W38 A42 V45 W49 F94 F97 H98 E101 R104 W105
BS07	CHL	4	Y135 F136 L142 E146 F150	Y82 F83 L89 E93 F97
BS08	CLA	4	M104 Y185 P186 G187 F195 A201 E205	M51 Y132 P133 G134 F142 A148 E152
BS09	CHL	4	R101 W102 V153 R156 R157 F190	R48 W49 V100 R103 R104 F137
BS10	CLA	4	H237 P241 W242	H184 P188 W189
BS11	CLA	4	G218 V221 Q222 H237 T245 I246	G165 V168 Q169 H184 T192 I193
BS12	CLA	4	K204 L211	K151 L158
BS13	CLA	4	K204 A207	K151 A154
BS14	CLA	4	G109 V124	G56 V71
BS15	CLA	4	F147 H151 W158	F94 H98 W105
BS16	CLA	4	W91 F92 F216	W38 F39 F163

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0016168	chlorophyll binding
GO:0019904	protein domain specific binding
GO:0046872	metal ion binding

	Biological Process
GO:0009409	response to cold
GO:0009644	response to high light intensity
GO:0009645	response to low light intensity stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0005829	cytosol
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009534	chloroplast thylakoid
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0009941	chloroplast envelope
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8j7b, PDBe:8j7b, PDBj:8j7b
PDBsum	8j7b
PubMed	37936349
UniProt	P27521\|CA4_ARATH Chlorophyll a-b binding protein 4, chloroplastic (Gene Name=LHCA4)

[Back to BioLiP]